PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca50897.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 324aa    MW: 36914.2 Da    PI: 9.5244
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca50897.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.81.3e-17244277134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 C++Cg++kTp+WR+gp g  tLCnaCG+ yr  +
  Dca50897.1 244 CQHCGSSKTPQWREGPAGRNTLCNACGVQYRNGR 277
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.5E-13238288IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.202238274IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-12238296No hitNo description
Gene3DG3DSA:3.30.50.106.1E-14243275IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.30E-14243300No hitNo description
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15244277IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDSPKNDKIL GITSENNHKP FHYSSCGQEL NMEIVNQYGQ LVGEFSRLDD ELWLTSPDHH  60
DSFHLWSTGF DEFHHSSSSY QLYQHDDHPP MSECTHKTVS DGVITPVEKN DSSLTDSSPN  120
QSQNQSPDSV LQRGLFFVET KPVTRRARSK RQRHHSGRMF SQFRFYETLL IPKKHTTSIV  180
LEETTDSFST KPVRTRKISE LLQIPNSDGR KTGQKNLKDG LRNGKPGSQP ISKRKLPRAE  240
VKTCQHCGSS KTPQWREGPA GRNTLCNACG VQYRNGRLFP EYRPLGSPTY NPSIHSCRPK  300
KVRGIRMSTI SEDKNRFSQH GCES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45170.11e-24GATA transcription factor 14